A practical reference on GSSG: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2025-09-23. Anything still debated is marked as such rather than presented as settled.
Synthesis occurs in two ATP-dependent steps: glutamate-cysteine ligase joins glutamate and cysteine to form gamma-glutamylcysteine, and glutathione synthetase adds glycine to complete the tripeptide. The pathway is feedback-inhibited by GSH and limited by cysteine availability, so cysteine supply often constrains production. Once formed, GSH participates in redox buffering, xenobiotic conjugation, and protein glutathionylation. Glutathione peroxidase uses GSH to reduce hydrogen peroxide and lipid peroxides, yielding GSSG, while glutathione reductase regenerates GSH using NADPH. Glutathione S-transferases conjugate electrophiles to GSH, supporting detoxification and excretion.
Because GSH is central to redox balance, its status is studied in aging, liver disease, neurodegenerative conditions, and metabolic disorders. Observational studies often report lower GSH or higher GSSG in affected tissues, but such associations do not establish that raising glutathione changes disease outcomes. Oral glutathione is digested into amino acids, and whether intact absorption occurs remains debated; precursors such as N-acetylcysteine and cysteine donors are also investigated. Regulatory agencies generally treat glutathione as a dietary supplement, not an approved drug, and clinical claims require evidence from controlled trials.
Glutathione is a small tripeptide composed of glutamate, cysteine, and glycine, with the unusual gamma-glutamyl linkage between glutamate and cysteine. Its cysteine thiol group makes it a major non-enzymatic antioxidant in cells. The reduced form, GSH, predominates in most intracellular compartments, while the oxidized disulfide form, GSSG, is produced when GSH reduces reactive oxygen species. Intracellular concentrations often reach millimolar levels, whereas plasma concentrations are much lower, typically in the low micromolar range. This gradient reflects active synthesis, transport, and consumption rather than passive distribution.
Quality control for glutathione focuses on identity, purity, and oxidation state. Certificates of analysis may report assay value, water content, and the presence of GSSG or other impurities. Chromatographic purity is often expressed as a percentage of peak area. Reference standards help laboratories compare results across instruments and batches. Because glutathione is a small, polar molecule, separation from cysteine, gamma-glutamylcysteine, and related thiols can be challenging. Verification often combines more than one analytical technique.
Measuring glutathione requires attention to sample preparation because the molecule oxidizes readily. Blood, tissue, and cell samples are often treated with acid to precipitate proteins and stabilize the thiol. Without such steps, GSH can convert to GSSG or form mixed disulfides during storage. Analytical methods include spectrophotometric assays, high-performance liquid chromatography, and mass spectrometry. Each approach has different sensitivity, specificity, and susceptibility to interference from related compounds in complex matrices.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C10H17N3O6S | Tripeptide of glutamate, cysteine, and glycine. |
| Molar mass | 307.32 g/mol | Calculated from the molecular formula. |
| Appearance | White to off-white powder | Typically crystalline or lyophilized solid. |
| Solubility | Soluble in water; insoluble in ethanol | Aqueous solutions are acidic and prone to oxidation. |
| Typical storage | -20 °C, desiccated, protect from light | Reduce exposure to oxygen and moisture. |
Cells synthesize glutathione through two ATP-dependent steps: glutamate-cysteine ligase joins glutamate and cysteine, and glutathione synthetase adds glycine to form the complete tripeptide. Breakdown occurs through gamma-glutamyl transpeptidase and subsequent peptidase reactions, forming the gamma-glutamyl cycle. Within cells, glutathione also forms a disulfide-linked dimer called GSSG when two GSH molecules react. The balance between GSH and GSSG is widely used as an indicator of oxidative conditions, although the ratio can vary by compartment and tissue.
Glutathione supports several cellular processes beyond direct antioxidant action. It serves as a cofactor for glutathione peroxidase and glutathione S-transferase enzymes, which reduce peroxides and conjugate electrophiles, respectively. The molecule also acts as a reservoir of cysteine, an amino acid that can limit protein synthesis and redox signaling. In human nutrition, oral glutathione is sold as a supplement, but how much intact glutathione reaches tissues after ingestion remains an active research question. Clinical claims about supplementation are not uniformly supported by controlled trials.
Storage recommendations for glutathione reagents usually specify a cool, dry, dark environment because the thiol oxidizes in air and light. Solid material is often kept desiccated at low temperature, while solutions are prepared fresh or stored frozen in aliquots. Repeated freeze-thaw cycles can accelerate degradation, and metal ions can catalyze oxidation. Quality control may include purity assays, water content, and identity confirmation. Stability limits are method-specific, so a stated shelf life applies only to defined conditions and packaging.
Laboratory measurement of glutathione requires attention to oxidation before analysis. Blood, tissue, or cell samples can lose reduced glutathione as it converts to GSSG or forms mixed disulfides with proteins. Acid extraction, rapid freezing, and thiol-blocking reagents are common strategies to preserve the original distribution. Reported concentrations therefore depend on collection protocol, extraction method, and the time between sampling and analysis. Comparisons across studies are most reliable when these pre-analytical variables are described.
=== Sequence data === Most of the work on substitution models has focused on DNA/RNA and protein sequence evolution. Models of DNA sequence evolution, where the alphabet corresponds to the four nucleotides (A, C, G, and T), are probably the easiest models to understand. DNA models can also be used to examine RNA virus evolution; this reflects the fact that RNA also has a four nucleotide alphabet (A, C, G, and U). However, substitution models can be used for alphabets of any size; the alphabet is the 20 proteinogenic amino acids for proteins and the sense codons (i.e., the 61 codons that encode amino acids in the standard genetic code) for aligned protein-coding gene sequences. In fact, substitution models can be developed for any biological characters that can be encoded using a specific alphabet (e.g., amino acid sequences combined with information about the conformation of those amino acids in three-dimensional protein structures). The majority of substitution models used for evolutionary research assume independence among sites (i.e., the probability of observing any specific site pattern is identical regardless of where the site pattern is in the sequence alignment). This simplifies likelihood calculations because it is only necessary to calculate the probability of all site patterns that appear in the alignment then use those values to calculate the overall likelihood of the alignment (e.g., the probability of three "GGGG" site patterns given some model of DNA sequence evolution is simply the probability of a single "GGGG" site pattern raised to the third power).
== References == (in French) Michel de Boüard, History of Normandy, Toulouse, 2001, ISBN 2-7089-1707-2 (in French) Pierre Gras, The Time of Ports, Decline and Recovery of Port Cities (1940–2010), Tallandier, 2010, 298 pages, ISBN 978-2-84734-675-6 (in French) Claire Étienne-Steiner, Le Havre. City, Port, and Agglomeration, Connaissance du patrimoine de Haute-Normandie, Rouen, 1999, ISBN 2-910316-19-X
=== Microneedle vaccines === A microneedle approach, which is still in stages of development, uses "pointed projections fabricated into arrays that can create vaccine delivery pathways through the skin".
The binding of tyrosine hydroxylase to membranes involves the N-terminal region of the enzyme, and may be regulated by a three-way interaction between 14-3-3 proteins, the N-terminal region of tyrosine hydroxylase, and negatively charged membranes. Tyrosine hydroxylase can also be regulated by inhibition. Phosphorylation at Ser40 relieves feedback inhibition by the catecholamines dopamine, epinephrine, and norepinephrine. The catecholamines trap the active-site iron in the Fe(III) state, inhibiting the enzyme. It has been shown that the expression of tyrosine hydroxylase can be affected by the expression of SRY. The down regulation of the SRY gene in the substantia nigra can result in a decrease in tyrosine hydroxylase expression. Long term regulation of tyrosine hydroxylase can also be mediated by phosphorylation mechanisms. Hormones (e.g. glucocorticoids), drugs (e.g. cocaine), or second messengers such as cAMP increase tyrosine hydroxylase transcription. Increase in tyrosine hydroxylase activity due to phosphorylation can be sustained by nicotine for up to 48 hours. Tyrosine hydroxylase activity is regulated chronically (days) by protein synthesis.
On election night, incumbent prime minister Anutin Charnvirakul of the Bhumjaithai Party claimed victory on projections giving his party around 194 seats, while Natthaphong Ruengpanyawut conceded on projections of just over 116 seats for the opposition People's Party. The Pheu Thai Party, led by Yodchanan Wongsawat, was projected third on around 76 seats. The Election Commission certified 396 constituency seats on 25 February and three more on 4 March, along with all 100 party-list seats. Certification of Suphan Buri constituency 2 was withheld over suspected misconduct by polling officials and was issued on 8 April, bringing the House to its full membership of 500. The certified results gave Bhumjaithai 192 seats, the People's Party 120 and Pheu Thai 74.
Sources: en.wikipedia.org
== Production == Ron Shapiro – executive producer, A&R James Hunter – A&R Patrick Leonard – producer arrangements Duncan Sheik – co-producer arrangements Michele Arifty – personal assistant to Patrick Leonard Lisa Marie – representative Suzanne Ybarra – representative Moir/Marie Entertainment – representation company Jim Goodkind – legal affairs Loeb & Loeb – legal affairs Katrina Leigh – project coordinator Lynn Kowalewski – art direction Allen Hori – design Philippe McClelland – photography Technical credits
Many homes have a large kitchen area devoted to preparation of meals and food, and may have a dining room, dining hall, or another designated area for eating. Most societies also have restaurants, food courts, and food vendors so that people may eat when away from home, when lacking time to prepare food, or as a social occasion. At their highest level of sophistication, these places become "theatrical spectacles of global cosmopolitanism and myth." At picnics, potlucks, and food festivals, eating is the primary purpose of a social gathering. At many social events, food and beverages are made available to attendees. People usually have two or three meals a day. Snacks of smaller amounts may be consumed between meals. Doctors in the UK recommend three meals a day (with between 400 and 600 kcal per meal), with four to six hours between. Having three well-balanced meals (described as: half of the plate with vegetables, 1/4 protein food as meat, [...] and 1/4 carbohydrates as pasta, rice) will then amount to some 1800–2000 kcal, which is the average requirement for a regular person. In jurisdictions under Sharia law, eating may be proscribed for Muslim adults during the daylight hours of Ramadan.
Like its menu, the equipment the company cooks its hamburgers with has also evolved as the company expanded. The burgers have always been broiled mechanically; the original unit, called an Insta-Broiler, was one of two pieces of equipment the founders of Insta-Burger King purchased before opening their new restaurant. The Insta-Broiler worked by cooking 12 burger patties in a wire basket, allowing the patties to be cooked from both sides simultaneously. When McLamore and Edgerton took over the company, besides dropping the "Insta-" prefix, they switched to an improved unit called a "Flame Broiler". Designed by the two and featuring stationary burners that cooked the meat on a moving chain, the unit broke down less often while maintaining a similar cooking rate. The company would stay with that format for the next 40 years until Burger King began developing a variable speed broiler that could handle multiple items with different cooking rates and times. These new units began testing in 1999 and eventually evolved into the two models the company deployed system-wide in 2008–2009. Accompanying these new broilers was new food-holding equipment, accompanied with a computer-based product monitoring system for its cooked products. The monitoring system allows for more concise tracking of product quality while giving the company and its franchisees a method to streamline costs by more precisely projecting sales and product usage.
More potential nutrients from the grape must (though the bacteria will be competing with the yeast for these) Lower sulfur dioxide and ethanol levels which can otherwise inhibit the LAB Higher fermentation temperatures which are more conducive to LAB growth and an earlier completion of MLF: The optimal temperatures for malolactic fermentation are between 20 and 37 °C (68 and 99 °F), while the process is significantly inhibited at temperatures below 15 °C (59 °F). Wine stored in the barrels in the cellar during the winter following fermentation will often have a very prolonged malolactic fermentation due to the cool cellar temperatures. Early completion of malolactic fermentation means the winemaker can make a postfermentation SO2 earlier to protect the wine from oxidation and spoilage microbes (such as Acetobacter). Since sulfur dioxide can inhibit MLF, delaying LAB inoculation till after alcoholic fermentation may mean a delay in sulfur addition till early spring when cellar temperatures warm up enough to encourage the completion of MLF. Less diacetyl production The disadvantages for early inoculation include:
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
SNX8 is thought to be an adaptor protein involved in the endosome-to-Golgi transport pathway, participating in endocytosis and endosomal sorting and signaling. It downregulates retrograde transport of intracellular proteins from the early endosome compartment to the trans-Golgi network in a retromer-mediated manner. SNX8 is therefore localized in early endosomes, as its colocalization with components of the retromer such as SNX1, SNX2, Vps26 and Vps35 has been demonstrated by some studies (and also with EEA1). Furthermore, the dynamics of endosomal structures with SNX8-enriched membrane domains are regulated by the opposite motor proteins dynein-1 containing LIC1 and kinesin-1, both of which allow SNX8-mediated cargo movement through the cytosol by exerting forces on these structures. The biological functions of SNX8 that have been studied, all of which involve its role in intracellular endosomal transport, are explained in more detail in the following sections.
Carbon (6C) has 14 known isotopes, from 8C to 20C as well as 22C, of which only 12C and 13C are stable. The longest-lived radioisotope is 14C, with a half-life of 5700 years. This is also the only carbon radioisotope found in nature, as trace quantities are formed cosmogenically by the reaction 14N + n → 14C + 1H. The most stable artificial radioisotope is 11C, which has a half-life of 20.34 minutes. All other radioisotopes have half-lives under 20 seconds, most less than 200 milliseconds. Lighter isotopes exhibit beta-plus decay into isotopes of boron and heavier ones beta-minus decay into isotopes of nitrogen, though at the limits particle emission occurs as well. The two lightest isotopes decay into helium via short-lived isotopes of lithium, beryllium and boron.
10 July Dynamic shell formation is demonstrated experimentally for the first time. Researchers claim their technique is a feasible target for mass production of fusion energy. The highest albedo ever measured for an exoplanet is confirmed using data from the CHEOPS space telescope. The ultra-hot Neptune LTT 9779 b is shown to reflect 80% of incoming light from its star (compared to 75% for Venus), due to the high metal content of its clouds. 11 July Three possible "dark star" candidates are reported, at times ranging from about 320 million to 400 million years after the Big Bang, based on analysis of observations by the James Webb Space Telescope Berkeley Earth reports that June 2023 was the warmest June since records began in 1850, and broke the previous record by 0.18 °C. Its temperature dataset suggests that 2023 is now 81% likely to become a new record year for global warming. A study suggests that carbon taxation approaches or instruments would be more effective and fairer when distinguishing between luxury- and basic goods and services. A separate study (17 July) finds that for energy demand reduction (EDR), "capping energy use of the top quintile of consumers" would be effective, more equitable, and increase public acceptance of transformative climate action in Europe. 12 July Astronomers report considerable success of the James Webb Space Telescope (JWST) after its first year of operations.
Limulus polyphemus, Atlantic horseshoe crab (2014) Carcinoscorpius rotundicauda, mangrove horseshoe crab (2021) Tachypleus gigas, coastal horseshoe crab (2020) Tachypleus tridentatus, tri-spine horseshoe crab (2021) Order Ixodida:
Sources: en.wikipedia.org
GSH is the reduced, thiol-containing form of glutathione, while GSSG is the oxidized disulfide dimer formed when two GSH molecules react. Cells maintain a high GSH-to-GSSG ratio under normal conditions. A shift toward GSSG is often interpreted as oxidative stress, though sample handling can affect the measured ratio.
No. It is a tripeptide made from three amino acids: glutamate, cysteine, and glycine. The gamma-glutamyl bond is unusual and distinguishes it from typical peptide linkages.
Most ingested glutathione is broken down in the gastrointestinal tract into its constituent amino acids. Some formulations may protect it from digestion, but intact absorption and delivery to specific tissues remain uncertain. Research continues on precursors and delivery methods.
Common methods include spectrophotometric enzyme cycling assays, HPLC with UV or fluorescence detection, and LC-MS/MS. Detection often requires derivatization because glutathione lacks a strong chromophore. Method choice depends on the sample type and the required sensitivity.