GSSG comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2025-12-16. Where a claim depends on a specific study, the study is described rather than over-claimed.
Storage recommendations for glutathione reagents usually specify a cool, dry, dark environment because the thiol oxidizes in air and light. Solid material is often kept desiccated at low temperature, while solutions are prepared fresh or stored frozen in aliquots. Repeated freeze-thaw cycles can accelerate degradation, and metal ions can catalyze oxidation. Quality control may include purity assays, water content, and identity confirmation. Stability limits are method-specific, so a stated shelf life applies only to defined conditions and packaging.
Laboratory measurement of glutathione requires attention to oxidation before analysis. Blood, tissue, or cell samples can lose reduced glutathione as it converts to GSSG or forms mixed disulfides with proteins. Acid extraction, rapid freezing, and thiol-blocking reagents are common strategies to preserve the original distribution. Reported concentrations therefore depend on collection protocol, extraction method, and the time between sampling and analysis. Comparisons across studies are most reliable when these pre-analytical variables are described.
Common analytical approaches include enzymatic recycling assays, high-performance liquid chromatography, and mass spectrometry. The enzymatic recycling assay uses glutathione reductase and a colorimetric or fluorometric reagent to amplify signal, which gives good sensitivity for total glutathione. Chromatographic methods can separate GSH from GSSG and related thiols, while mass spectrometry offers structural confirmation and multiplexing. Each approach has different requirements for calibration, internal standards, and validation. No single method captures every form of glutathione in every matrix.
Functionally, glutathione supports redox balance by donating electrons and becoming oxidized. It also serves as a cofactor for enzymes such as glutathione peroxidases and glutathione S-transferases. These enzymes participate in peroxide reduction and in conjugation reactions that help process reactive molecules. Separate from antioxidant roles, glutathione can modify protein cysteines through S-glutathionylation, influencing enzyme activity and signaling. Research continues to examine how these chemical roles translate into whole-organism effects.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. Its glutamate-cysteine linkage uses the gamma-carboxyl group of glutamate, a feature that resists standard peptidases. The cysteine residue provides a thiol group, which gives the molecule its reducing character. In cells, glutathione is often the most abundant small-molecule thiol, with concentrations varying widely by tissue and compartment. It exists mainly in a reduced form called GSH, while oxidation produces a disulfide-linked dimer called GSSG.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | -20 °C or below | For solid reagent and frozen aliquots; protect from moisture and light. |
| Common analytical method | HPLC with UV or fluorescence detection | Separates GSH and GSSG after derivatization or direct detection. |
| Alternative method | LC-MS/MS | Provides high specificity and can quantify multiple thiols. |
| Total glutathione assay | Enzymatic recycling | Uses glutathione reductase and a chromogen or fluorogen. |
| Key stability risk | Oxidation to GSSG | Air, light, and trace metals promote conversion. |
Commercial glutathione is available in research-grade, food-grade, and supplement-grade forms, and purity specifications differ accordingly. Certificates of analysis commonly report identity by nuclear magnetic resonance or mass spectrometry, purity by HPLC, residual solvents, and heavy metals. Reference standards with assigned purity support calibration, while isotopically labeled glutathione can serve as an internal standard for mass spectrometry. For supplements, label claims may not be independently verified, and regulatory oversight varies by country. Verification often involves third-party testing for identity, potency, and contaminants.
Quantifying glutathione requires distinguishing GSH from GSSG and preventing oxidation during sample preparation. Common approaches include the enzymatic recycling assay, often called the Tietze method, which measures total glutathione after converting GSSG to GSH. HPLC with ultraviolet or fluorescence detection and LC-MS/MS can separate and quantify both forms, sometimes after derivatization of the thiol group. Blood, plasma, and tissue samples differ in matrix and baseline concentrations, so method validation must account for recovery, linearity, and interference. No single assay is universally standard.
Glutathione is most stable as a dry powder stored cool and dry, but its thiol group is readily oxidized in solution. Aqueous preparations at neutral or alkaline pH lose GSH faster because the thiolate form reacts with dissolved oxygen and metal ions. Acidic conditions, chelating agents, and oxygen exclusion can slow oxidation, while repeated freeze-thaw cycles promote degradation. Light exposure and trace metals also contribute to loss. Laboratories typically validate stability for their own matrices because degradation rates depend on pH, temperature, concentration, and container materials.
Glutathione participates in detoxification reactions, amino acid transport, and the maintenance of protein thiols. It serves as a cofactor for several enzymes, including glutathione peroxidases and glutathione S-transferases. In research literature, altered glutathione status appears in studies of aging, infection, metabolic stress, and environmental exposure. Whether low glutathione is a cause, consequence, or marker of such conditions often remains unresolved. Direct measurement in blood or tissue provides a snapshot, but results depend on sample handling, timing, and the method used.
Glutathione is a small tripeptide made of glutamic acid, cysteine, and glycine. Its cysteine thiol group allows reversible oxidation and reduction, making it central to cellular redox chemistry. The reduced form, often abbreviated GSH, predominates inside most cells, while the oxidized disulfide form, GSSG, forms when two GSH molecules react. The ratio of GSH to GSSG is widely used as an indicator of oxidative stress in laboratory research, though it does not by itself diagnose a clinical condition.
Biosynthesis occurs in two ATP-dependent steps. The enzyme glutamate-cysteine ligase joins glutamate and cysteine, forming gamma-glutamylcysteine; glutathione synthetase then adds glycine to produce the complete tripeptide. Because the peptide bond from glutamate uses the gamma-carboxyl group, glutathione resists digestion by many ordinary peptidases. Tissues vary in synthesis capacity, and the liver generally contains high concentrations relative to many other organs. This uneven distribution contributes to organ-specific differences in redox buffering and affects how experimental results are interpreted across tissue types.
The protein design conformational space can be represented as a tree, where the protein residues are ordered in an arbitrary way, and the tree branches at each of the rotamers in a residue. Branch and bound algorithms use this representation to efficiently explore the conformation tree: At each branching, branch and bound algorithms bound the conformation space and explore only the promising branches. A popular search algorithm for protein design is the A* search algorithm. A* computes a lower-bound score on each partial tree path that lower bounds (with guarantees) the energy of each of the expanded rotamers. Each partial conformation is added to a priority queue and at each iteration the partial path with the lowest lower bound is popped from the queue and expanded. The algorithm stops once a full conformation has been enumerated and guarantees that the conformation is the optimal. The A* score f in protein design consists of two parts, f=g+h. g is the exact energy of the rotamers that have already been assigned in the partial conformation. h is a lower bound on the energy of the rotamers that have not yet been assigned. Each is designed as follows, where d is the index of the last assigned residue in the partial conformation.
=== Europe === The prevalence of congenital corneal opacities (CCO) is estimated to be 3 in 100,000 newborns. This number increases to 6 in 100,000 if congenital glaucoma patients are included. A study of live births in Spain reported that corneal opacities accounted for 3.11% of congenital eye malformations (Bermejo et al, 1998). About 4% of keratoplasties done in the pediatric population in Denmark are due to congenital anomalies (Hovlykke et al, 2014).
Fluoxetine has been shown to inhibit acid sphingomyelinase, a key regulator of ceramide levels which derives ceramide from sphingomyelin. Fluoxetine has a direct interaction with Tropomyosin receptor kinase B (TrkB), in which fluoxetine binds to the cholesterol site on TrkB, which "facilitates" Brain-derived neurotrophic factor signalling and reduces the amount of TrkB in a inactive state. This action also raises the surface expression of TrkB receptors.
University-based ophthalmologists in the US and Canada further refined the use of botulinum toxin as a therapeutic agent. By 1985, a scientific protocol of injection sites and dosage had been empirically determined for treatment of blepharospasm and strabismus. Side effects in treatment of this condition were deemed to be rare, mild and treatable. The beneficial effects of the injection lasted only four to six months. Thus, blepharospasm patients required re-injection two or three times a year. In 1986, Scott's micromanufacturer and distributor of Botox was no longer able to supply the drug because of an inability to obtain product liability insurance. People became desperate, as supplies of Botox were gradually consumed, forcing him to abandon people who would have been due for their next injection. For a period of four months, American blepharospasm patients had to arrange to have their injections performed by participating doctors at Canadian eye centers until the liability issues could be resolved. In December 1989, Botox was approved by the US FDA for the treatment of strabismus, blepharospasm, and hemifacial spasm in people over 12 years old. In the case of treatment of infantile esotropia in people younger than 12 years of age, several studies have yielded differing results.
Finding the structure of proteins is an important application of bioinformatics. The Critical Assessment of Protein Structure Prediction (CASP) is an open competition where worldwide research groups submit protein models for evaluating unknown protein models.
Sources: en.wikipedia.org
During the first half of the 20th century, the 129th regiment of infantry of the line was stationed at Le Havre and left an important mark on the city so a street was named after them. The 74th Infantry Regiment of commandos was present from 1963 to 1976. Finally, Le Havre is the godmother city for BPC Mistral. The ceremony was held at the City Hall on 15 November 2009, during a stopover at the Building.
The prokineticin receptor is a G protein-coupled receptor which binds the peptide hormone prokineticin. There are two variants each encoded by a different gene (PROKR1, PROKR2). These receptors mediate gastrointestinal smooth muscle contraction and angiogenesis.
== Functional characteristics == With the ability to kill gram-positive and gram-negative bacteria, fungi, spirochetes and some enveloped viruses, cryptdins are classified as broad-spectrum antimicrobial peptides. Although it is the least expressed of the six isoforms, cryptdin-4 is the most bactericidal. Procryptdins, however, are nonbactericidal and thus require degradation of the proregion by MMP-7 for activation. In response to bacterial antigens, Paneth cells release their secretory granules into the lumen of intestinal crypts. There, cryptdins, along with other antimicrobial peptides expressed by Paneth cells, contribute to enteric mucosal innate immunity by clearing the intestinal crypt of potential invading pathogens.
== Development == Development of Half-Life 2 began in June 1999, six months after the release of the original Half-Life. It was developed by a team of 82, or around 100 people including voice actors. Valve's president, Gabe Newell, wanted to redefine the FPS genre, saying: "Why spend four years of your life building something that isn't innovative and is basically pointless? If Half-Life 2 isn't viewed as the best PC game of all time, it's going to completely bum out most of the guys on this team." Newell gave his team no deadline and a "virtually unlimited" budget, promising to fund the project himself if necessary. They used Valve's new in-house game engine, Source, developed simultaneously.
Vascular tissues are used to move hormones from one part of the plant to another; these include sieve tubes or phloem that move sugars from the leaves to the roots and flowers, and xylem that moves water and mineral solutes from the roots to the foliage. Not all plant cells respond to hormones, but those cells that do are programmed to respond at specific points in their growth cycle. The greatest effects occur at specific stages during the cell's life, with diminished effects occurring before or after this period. Plants need hormones at very specific times during plant growth and at specific locations. They also need to disengage the effects that hormones have when they are no longer needed. The production of hormones occurs very often at sites of active growth within the meristems, before cells have fully differentiated. After production, they are sometimes moved to other parts of the plant, where they cause an immediate effect; or they can be stored in cells to be released later. Plants use different pathways to regulate internal hormone quantities and moderate their effects; they can regulate the amount of chemicals used to biosynthesize hormones. They can store them in cells, inactivate them, or cannibalise already-formed hormones by conjugating them with carbohydrates, amino acids, or peptides. Plants can also break down hormones chemically, effectively destroying them. Plant hormones frequently regulate the concentrations of other plant hormones. Plants also move hormones around the plant diluting their concentrations.
Sources: en.wikipedia.org
=== Section Praegnans === Cyclopia alopecuroides A.L. Schutte Cyclopia aurescens Kies Cyclopia bolusii Hofmeyr & E. Phillips Cyclopia bowieana Harv. Cyclopia glabra (Hofmeyr & E. Phillips) A.L. Schutte Cyclopia meyeriana Walp.
A less centralized federal system was proposed by Gorbachev during the Communist Party Congress of July 1990. A draft of the New Union Treaty was submitted to the Supreme Soviet of the Soviet Union on 23 November 1990. A drafting committee started work on the text on 1 January 1991. Six of the fifteen Soviet republics, however, did not participate in the drafting of the treaty: Armenia, Georgia, Moldova, Estonia, Latvia and Lithuania. The proposal was approved by the Soviet of the Union on 6 March and sent to the Supreme Soviets of each republic for approval. Agreement could not be reached on the distribution of power between the Union and the Republics and the proposal was not approved. Gorbachev tried to gain popular support for the proposal. On 17 March 1991, the nine republics (Russia, Byelorussia, Ukraine, Azerbaijan, Kazakhstan, Kyrgyzstan, Tajikistan, Turkmenistan, and Uzbekistan) which participated in the drafting of the treaty held a popular referendum. 76% of voters supported maintaining the federal system of the Soviet Union, including a majority in all of the nine republics. Opposition was greatest in large cities like Leningrad and Moscow. As the other six republics were already moving towards independence, citizens mostly boycotted the referendum. An agreement between the Soviet central government and the nine republics, known as the 9 + 1 agreement, was finally signed in Novo-Ogaryovo on 23 April. The New Union Treaty would have converted the Soviet Union into a confederation of independent republics with a common president, foreign policy, and military.
== Effects == Hydrocodone causes respiratory depression and miosis. Hydrocodone decreases gastrointestinal (GI) motility by increasing smooth muscle tone and decreasing propulsive contractions, which may result in constipation. Hydrocodone causes dilation of peripheral blood vessels, which can cause hypotension and syncope. Vasodilation coupled with histamine release can result in pruritus, sweating and flushing. Hydrocodone, like other opioids, stimulates the secretion of prolactin, growth hormone (GH), insulin and glucagon. Conversely, hydrocodone inhibits adrenocorticotropic hormone (ACTH), cortisol and luteinizing hormone (LH) secretion. Chronic hydrocodone use can lead to androgen deficiency, which may result in low libido, impotence, erectile dysfunction, amenorrhea or infertility. Hydrocodone use can suppress the immune system.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The tertiary structure and topology of TMEM125 was predicted and visualized through Phyre2. TMEM125 has 1 predicted phosphorylation site (CK2 Phos), 5 predicted N-myristoylation sites (N-myr), 2 predicted palmitoylation sites (Pal), and 1 predicted amidation site (Amid). It also contains the domain of unknown function 66 (DUF66). TMEM125 is predicted to be subcellularly localized in the plasma membrane. It is secondarily predicted to be localized in the endoplasmic reticulum. There were no scientifically-verified protein interactions identified for TMEM125. String Protein Interaction predicted 10 functional protein partners for TMEM125, but all were determined through textmining. TMEM125 is conserved in species as distantly related to humans as cartilaginous fish, that’s most recent common ancestor to humans existed 465 million years ago. TMEM125 is highly conserved in primates, mammals, birds, reptiles, bony fish, and cartilaginous fish, but is not observed in invertebrates. TMEM125 does not have any paralogs.
Sources: en.wikipedia.org
Pre-analytical handling, extraction chemistry, and detection method all influence reported glutathione values. Oxidation during sample processing can shift the measured GSH/GSSG ratio. Standardized protocols and reference materials help reduce, but do not eliminate, these differences.
Total glutathione typically refers to the combined amount of reduced glutathione and glutathione disulfide, expressed in glutathione equivalents. Assays that measure total glutathione do not distinguish GSH from GSSG unless a separation step is included. Researchers often pair a total assay with a specific GSSG measurement to estimate the redox ratio.
Glutathione reference standards are generally stored cold, dry, and protected from light. Weighed portions should be prepared promptly and used within validated stability windows. Purity and water content can affect the accuracy of calibration curves.
Glutathione is a sulfur-containing tripeptide made from glutamate, cysteine, and glycine. It is found in most cells and participates in redox balance and detoxification reactions.