thiol is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-05-13. Where a claim depends on a specific study, the study is described rather than over-claimed.
Laboratory measurement of glutathione requires attention to oxidation before analysis. Blood, tissue, or cell samples can lose reduced glutathione as it converts to GSSG or forms mixed disulfides with proteins. Acid extraction, rapid freezing, and thiol-blocking reagents are common strategies to preserve the original distribution. Reported concentrations therefore depend on collection protocol, extraction method, and the time between sampling and analysis. Comparisons across studies are most reliable when these pre-analytical variables are described.
Common analytical approaches include enzymatic recycling assays, high-performance liquid chromatography, and mass spectrometry. The enzymatic recycling assay uses glutathione reductase and a colorimetric or fluorometric reagent to amplify signal, which gives good sensitivity for total glutathione. Chromatographic methods can separate GSH from GSSG and related thiols, while mass spectrometry offers structural confirmation and multiplexing. Each approach has different requirements for calibration, internal standards, and validation. No single method captures every form of glutathione in every matrix.
In cells, glutathione exists mainly in a reduced form called GSH. When two GSH molecules react, they form oxidized glutathione, or GSSG, which contains a disulfide bond. The ratio of GSH to GSSG is often used as an indicator of oxidative stress. Enzymes such as glutathione peroxidase and glutathione reductase help cycle the molecule between these two states. This cycling supports antioxidant defense, detoxification of reactive molecules, and regulation of certain signaling pathways.
Glutathione is present in most tissues, with especially high concentrations in the liver. It also serves as a cofactor for some enzymes and helps transport amino acids across cell membranes. In plants and microorganisms, glutathione contributes to stress responses and metal handling. The molecule is synthesized in two ATP-dependent steps, first producing gamma-glutamylcysteine and then adding glycine. Because cysteine availability often limits synthesis, dietary and metabolic factors can influence glutathione levels. Research continues to examine how these levels relate to health and disease.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. The peptide bond between glutamate and cysteine uses the gamma-carboxyl group of glutamate rather than the alpha-carboxyl group. This unusual linkage protects the molecule from many common peptidases. The cysteine side chain carries a thiol group that can undergo reversible oxidation. Because of this thiol, glutathione participates in redox reactions and helps maintain the reducing environment inside most cells in living systems.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | -20 °C or below | For solid reagent and frozen aliquots; protect from moisture and light. |
| Common analytical method | HPLC with UV or fluorescence detection | Separates GSH and GSSG after derivatization or direct detection. |
| Alternative method | LC-MS/MS | Provides high specificity and can quantify multiple thiols. |
| Total glutathione assay | Enzymatic recycling | Uses glutathione reductase and a chromogen or fluorogen. |
| Key stability risk | Oxidation to GSSG | Air, light, and trace metals promote conversion. |
Glutathione is a small sulfur-containing peptide built from glutamic acid, cysteine, and glycine. Its distinctive feature is a gamma-glutamyl bond between glutamate's side-chain carboxyl group and cysteine's amino group. This linkage resists ordinary peptidases and helps the molecule remain stable inside cells. The reduced thiol form, often abbreviated GSH, is the dominant intracellular species. The oxidized disulfide dimer, GSSG, forms when two reduced molecules link through their cysteine sulfur atoms. The balance between these forms is a common redox indicator.
In living systems, glutathione occurs in millimolar concentrations in many cell types, while extracellular levels are generally much lower. The liver holds a substantial share of the body's total pool, and the molecule participates in reduction, detoxification, and amino acid transport. It also serves as a cofactor for enzymes such as glutathione peroxidase and glutathione S-transferase. Because the cysteine residue supplies a reactive thiol, glutathione can donate electrons and become oxidized. Cells regenerate reduced glutathione through glutathione reductase using NADPH.
Commercial glutathione is produced by microbial fermentation or chemical synthesis, then purified. Reduced and oxidized grades are offered separately, with purity specifications often exceeding 98 percent. The compound appears in foods such as fresh fruits, vegetables, and meats, although cooking and processing can lower amounts. Oral, topical, and inhaled forms are discussed in research and consumer contexts, but absorption and tissue delivery remain active areas of study. Regulatory status varies by country and intended use.
Cells synthesize glutathione through two ATP-dependent enzymatic steps. The first step combines glutamate and cysteine to form gamma-glutamylcysteine, catalyzed by glutamate-cysteine ligase. The second step adds glycine, producing the complete tripeptide, catalyzed by glutathione synthetase. Glutathione itself can inhibit the first enzyme, providing negative feedback when levels are high. Because cysteine is often limiting, its availability influences how quickly the pathway proceeds. These reactions occur in the cytosol, and the resulting glutathione can be distributed to other compartments.
Glutathione functions in redox balance, detoxification, and sulfur amino acid storage. It participates in reactions that help maintain ascorbate and protein thiol status. The molecule serves as a cofactor for several enzymes, including glutathione peroxidases and glutathione S-transferases. These enzymes reduce peroxides and conjugate electrophiles, respectively. Glutathione also contributes to the metabolism of xenobiotics and to the transport of cysteine between tissues. How interorgan transport and tissue-specific regulation shape whole-body pools remains an active area of study.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. Its cysteine residue carries a thiol group, which allows the molecule to participate in reduction and oxidation reactions. The compound exists in most living cells, where the reduced form, often abbreviated GSH, is usually more abundant than the oxidized disulfide form, GSSG. Intracellular concentrations are commonly in the millimolar range, while extracellular concentrations are much lower. This uneven distribution supports its role as a major cellular redox buffer.
Glutathione serves as a cofactor for several enzymes, including glutathione peroxidase and glutathione S-transferase. These enzymes help reduce hydrogen peroxide and lipid peroxides, and they conjugate reactive electrophiles for excretion. The molecule also acts as a reservoir for cysteine, an amino acid that is prone to oxidation. In addition, glutathione participates in the metabolism of nitric oxide, leukotrienes, and prostaglandins. Its roles extend to cell signaling, apoptosis, and the regulation of protein function through S-glutathionylation.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine, and it is the most abundant non-protein thiol in most living cells. The reduced form, GSH, carries a sulfhydryl group that can donate electrons, while the oxidized form, GSSG, forms when two GSH molecules link via a disulfide bond. The balance between these two forms helps define the cellular redox environment, and their ratio is often used as an indicator of oxidative stress. Because the sulfhydryl group is reactive, glutathione participates in many cellular processes, including detoxification and protein regulation.
Glutathione is synthesized in two ATP-dependent steps. First, gamma-glutamylcysteine synthetase links glutamate and cysteine; second, glutathione synthetase adds glycine to form the complete tripeptide. The pathway is feedback-inhibited by GSH itself, which helps maintain steady intracellular levels. Tissues vary widely in glutathione content, with the liver typically containing the highest concentrations, followed by the kidneys, lungs, and erythrocytes. Because cysteine is often limiting, its availability influences synthesis rates, and regulation of this pathway varies by cell type.
Because GSH is central to redox balance, its status is studied in aging, liver disease, neurodegenerative conditions, and metabolic disorders. Observational studies often report lower GSH or higher GSSG in affected tissues, but such associations do not establish that raising glutathione changes disease outcomes. Oral glutathione is digested into amino acids, and whether intact absorption occurs remains debated; precursors such as N-acetylcysteine and cysteine donors are also investigated. Regulatory agencies generally treat glutathione as a dietary supplement, not an approved drug, and clinical claims require evidence from controlled trials.
Glutathione is a small tripeptide composed of glutamate, cysteine, and glycine, with the unusual gamma-glutamyl linkage between glutamate and cysteine. Its cysteine thiol group makes it a major non-enzymatic antioxidant in cells. The reduced form, GSH, predominates in most intracellular compartments, while the oxidized disulfide form, GSSG, is produced when GSH reduces reactive oxygen species. Intracellular concentrations often reach millimolar levels, whereas plasma concentrations are much lower, typically in the low micromolar range. This gradient reflects active synthesis, transport, and consumption rather than passive distribution.
An important technique for characterizing metal carbonyls is infrared spectroscopy. The C–O vibration, typically denoted νCO, occurs at 2143 cm−1 for carbon monoxide gas. The energies of the νCO band for the metal carbonyls correlates with the strength of the carbon–oxygen bond, and inversely correlated with the strength of the π-backbonding between the metal and the carbon. The π-basicity of the metal center depends on a lot of factors; in the isoelectronic series (titanium to iron) at the bottom of this section, the hexacarbonyls show decreasing π-backbonding as one increases (makes more positive) the charge on the metal. π-Basic ligands increase π-electron density at the metal, and improved backbonding reduces νCO. The Tolman electronic parameter uses the Ni(CO)3 fragment to order ligands by their π-donating abilities. The number of vibrational modes of a metal carbonyl complex can be determined by group theory. Only vibrational modes that transform as the electric dipole operator will have nonzero direct products and are observed. The number of observable IR transitions (but not their energies) can thus be predicted. For example, the CO ligands of octahedral complexes, such as Cr(CO)6, transform as a1g, eg, and t1u, but only the t1u mode (antisymmetric stretch of the apical carbonyl ligands) is IR-allowed. Thus, only a single νCO band is observed in the IR spectra of the octahedral metal hexacarbonyls. Spectra for complexes of lower symmetry are more complex. For example, the IR spectrum of Fe2(CO)9 displays CO bands at 2082, 2019 and 1829 cm−1.
The M Series (e.g., 2GO Maligaya, 2GO Masagana), named after Filipino words beginning with "Ma" that represent positive traits and attitudes of the Filipino people.) The S Series (e.g., St. Michael the Archangel, St. Francis Xavier), named after Roman Catholic saints.)
November 28, 2008: Canada In 2008, Canada had positive GDP growth in Q2 and Q3 but GDP fell by a sharp 3.4% annualized in Q4. Growth is widely expected to remain in recession territory going into 2009. Canada is the only OECD country out of the recession at this time.
=== Epstein-Barr virus === The Epstein-Barr virus (EBV) infects about 90 to 95% of adults and can cause infectious mononucleosis. A study of more than 10 million US military members compared 801 people who developed MS to 1,566 matched controls who did not. The study found a 32-fold increased risk of MS development following EBV infection. It did not find an increased risk after infection with other viruses, including the similar cytomegalovirus. These findings strongly suggest that EBV is necessary for MS onset, although EBV alone may be insufficient to cause it. The nuclear antigen of EBV, which is the most consistent marker of EBV infection across all strains, has been identified as a direct source of autoreactivity in the human body. These antigens appear more likely to promote autoimmunity in vitamin D deficient persons. The EBV protein EBNA1 shares similarities with three human proteins, including the brain protein GlialCAM. Because of molecular mimicry, the immune system in MS mistakenly may attack these proteins. Two are part of the nervous system, while the third is a "guardian molecule" which protects the body against autoimmunity.
Sources: en.wikipedia.org
=== Monoamine oxidase inhibitors === Monoamine oxidase inhibitors (MAOIs) are first-generation antidepressants effective for anxiety treatment but their dietary restrictions, adverse effect profile and availability of newer medications have limited their use. MAOIs include phenelzine, isocarboxazid and tranylcypromine. Pirlindole is a reversible MAOI that lacks dietary restriction.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
===== Acrididae ===== Locust swarming is initiated but not maintained by serotonin, with release being triggered by tactile contact between individuals. This transforms social preference from aversion to a gregarious state that enables coherent groups. Learning in flies and honeybees is affected by the presence of serotonin.
Sources: en.wikipedia.org
=== Hypertension-induced cardiovascular disorders === In a model where FFAR2 and FFAR3 were both deleted, these animals had an exaggerated response to hypertension, with higher fibrosis in the kidney; this was explained by a breakdown in the gut epithelial barrier and activation of the immune system via LPS/TLR4 binding. Studies in humans have found that individuals undergoing hemodialysis using dialysis solutions that contain acetic acid often develop hypotension; the role of FFAR3 in this response, if any, was not investigated. A study of 69 individuals (55.1% women, mean age 59.8 years) found that arterial stiffness was associated with lower levels of FFAR3 and FFAR2 in circulating blood immune cells (particularly regulatory T cells which are known to be protective in murine models of hypertension). Overall, the mouse studies suggest that FFAR3 contributes to suppressing hypertension and its subsequent effects on the heart in mice and that SC-FA-activated FFAR3 and/or FFAR2 may have vasodilatory actions and thereby suppress the development of hypertension and hypertension-induced arterial stiffness in humans. Further studies in humans are needed to investigate the latter possibilities.
Geologists consider her to be the "first woman geologist in this country (America)". 1893: American botanist Elizabeth Gertrude Britton became a charter member of the Botanical Society of America. 1894: American astronomer Margaretta Palmer became the first woman to earn a doctorate in astronomy. 1895: English physiologist Marion Bidder became the first woman to speak and present her own paper at a meeting of the Royal Society. 1896: Florence Bascom became the first woman to work for the United States Geological Survey. 1896: English mycologist and lichenologist Annie Lorrain Smith became a founding member of the British Mycological Society. She later served as president twice. 1896: Russian ophthalmologist Rosa Kerschbaumer-Putjata graduated from the University of Bern. She became the first female doctor permitted to practice in Austria due to a special permit granted by Emperor Franz Joseph I of Austria. She campaigned for women's right to study medicine in Austria. 1897: American cytologists and zoologists Katharine Foot and Ella Church Strobell started working as research partners. Together, they pioneered the practice of photographing microscopic research samples and invented a new technique for creating thin material samples in colder temperatures. 1897: American physicist Isabelle Stone became the first woman to receive a PhD in physics in the United States. She wrote her dissertation "On the Electrical Resistance of Thin Films" at the University of Chicago.
One contemporary news article claimed the murder was related to "the demoniac rites of West African savages, from whom Voodoo practices were transferred to West Indian Negroes, and from them to the United States."
Breast Acute myeloid leukemia Pancreatic ductal adenocarcinoma Ovarian B-cell lymphoma Renal cell carcinomas Lung Glioblastoma These forms of cancer have been hypothesized to be highly sensitive to ferroptosis induction. An upregulation of iron levels has also been seen to induce ferroptosis in certain types of cancer, such as breast cancer. Breast cancer cells have exhibited vulnerability to ferroptosis via a combination of siramesine and lapatinib. These cells also exhibited an autophagic cycle independent of ferroptotic activity, indicating that the two different forms of cell death could be controlled to activate at specific times following treatment. Furthermore, intratumor bacteria may scavenge iron by producing iron siderophores, which indirectly protect tumor cells from ferroptosis, emphasizing the need for ferroptosis inducers (thiostrepton) for cancer treatment. In various contexts, resistance to cancer therapy is associated with a mesenchymal state. A pair of studies in 2017 found that these cancer cells in this therapy-induced drug-resistant state exhibit a greater dependence on GPX4 to suppress ferroptosis. Consequently, GPX4 inhibition represents a possible therapeutic strategy to mitigate acquired drug resistance.
Sources: en.wikipedia.org
Pre-analytical handling, extraction chemistry, and detection method all influence reported glutathione values. Oxidation during sample processing can shift the measured GSH/GSSG ratio. Standardized protocols and reference materials help reduce, but do not eliminate, these differences.
Total glutathione typically refers to the combined amount of reduced glutathione and glutathione disulfide, expressed in glutathione equivalents. Assays that measure total glutathione do not distinguish GSH from GSSG unless a separation step is included. Researchers often pair a total assay with a specific GSSG measurement to estimate the redox ratio.
Glutathione reference standards are generally stored cold, dry, and protected from light. Weighed portions should be prepared promptly and used within validated stability windows. Purity and water content can affect the accuracy of calibration curves.
Glutathione is a tripeptide made from glutamate, cysteine, and glycine. Its cysteine residue provides a thiol group that is central to its redox activity. The glutamate-cysteine bond forms through the gamma-carboxyl group of glutamate.